PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C016389P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 242aa    MW: 26847.8 Da    PI: 8.8173
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C016389P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.61.1e-3149103459
     ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     vrY +ClkNhA+++Ggh++DGCgEfmps ge+gt++++kCaAC+CHR+FHRr  ee
  MELO3C016389P1  49 VRYSQCLKNHAVKTGGHVLDGCGEFMPS-GEDGTPDSFKCAACECHRSFHRRVLEE 103
                     89*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047706.0E-2949100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-1749102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.7E-285099IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.43351100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.93E-14161230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-26161230IPR009057Homeodomain-like
TIGRFAMsTIGR015652.0E-27173230IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MDLKNQQTTS SPDHHLPFQY SLRRPRTDPP PPPPLNPDPA PASPPSTPVR YSQCLKNHAV  60
KTGGHVLDGC GEFMPSGEDG TPDSFKCAAC ECHRSFHRRV LEEEDVTNNT SRLHILTSAA  120
PPYTSQFNNG NNNNNQYPRR TRVAPVMMTF GGSTEAPAES SSDGAEASGR QQKKRSRTKF  180
SGEQKGKMME LANKLGWKIQ KDDEEEVLKF CNEIGVKRQN FKVWMHNNKQ PPTNNNNNSS  240
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-181742291873ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818730.0LN681873.1 Cucumis melo genomic scaffold, anchoredscaffold00027.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008452084.10.0PREDICTED: zinc-finger homeodomain protein 6-like
TrEMBLA0A0A0KWP21e-143A0A0A0KWP2_CUCSA; Uncharacterized protein
STRINGPGSC0003DMT4000090333e-63(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2470633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-46homeobox protein 24